DPCstruct | MC2296
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 363 ± 68 aa |
| Standard deviation of domain lengths | 67.80 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 78.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 22.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A135SMI7 | 34-461 | KLRDALGKPIDLAFAYTCKRVADEMRGLALEANTITASTFYSPDERHRARDFDLVTMMLNEELENALHCSQHLLWDDTCDDISGAFP… |
| A0A6G1JM91 | 18-475 | QPVGLDLAYACKIAANEMRGIPFRTNKIKSTVGSSNNHQGGHRGLQSRAGRFRCLLKYAQETQLRMAFHIAELMTPQVLQSLEELVI… |
| A0A1L7W9F2 | 98-493 | None |
| A0A010S011 | 388-717 | None |
| I1S3A3 | 26-327 | None |
| A0A1B7XZW0 | 57-498 | None |
| A0A2H3H6V1 | 39-466 | None |
| A0A2P4ZF21 | 79-542 | None |
| A0A6A5U5H0 | 2-398 | None |
| W7N2U6 | 6-354 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.