DPCstruct | MC22956
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 615 ± 49 aa |
| Standard deviation of domain lengths | 49.49 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 64.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.71 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 35.66 |
| Pfam Score | 95.24 |
| Assigned Pfam label(s) | CL0195- PF15447 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A024UXE0 | 73-693 | TDRCNRDCKCFESWVKQKKEQEWTKIKEQFRKQDINGTGGSGNHVGLIAFNHDGVLEDVLKLEFANENIEEDKENNVSAEEIDLINK… |
| A0A0L7KL11 | 1-586 | MTADFVLKTELKGINKILEEEKQKSQAEVGADNQNNTTIDKLLKHEGEEAGECLKTHKEKCEKKAKPESVARSEDNQPALPDPTVNP… |
| A0A024WAL9 | 301-911 | None |
| A0A024WHA6 | 270-927 | None |
| W4I7R7 | 3-627 | None |
| Q8IAS7 | 667-1317 | None |
| Q8IAS3 | 730-1421 | None |
| A0A024VUA3 | 135-776 | None |
| A0A0L7KKP1 | 3-541 | None |
| A0A024UW73 | 2-527 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.