DPCstruct | MC2295
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 435 ± 43 aa |
| Standard deviation of domain lengths | 42.79 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 67.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 17.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A428P9C8 | 41-477 | KPPAPGQSNNSVTEKWKISKKIVYRIERDALPLNDDDRDSKAISAAAKAFFFRSRLSRMTGLHGSGSEHNSNWGAKFVPVREVAMIL… |
| A0A6G1JH02 | 13-481 | DSPKSESGLHQLGAKLGCPIWEISSNEDTNSRWLAQQEAGGEAAKIWRYRVRLSQLTSPSDEDSTTRAWPNELVESRSLSIGLVNVL… |
| A0A4V1XMJ3 | 357-727 | None |
| A0A2V1DW18 | 205-591 | None |
| A0A0P7BAW4 | 382-895 | None |
| A0A175VXE4 | 618-1110 | None |
| A0A2L2TI75 | 1-449 | None |
| A0A4V1XWJ0 | 392-832 | None |
| A0A4Q4X0P1 | 483-888 | None |
| A0A175VV69 | 513-945 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.