DPCstruct | MC22948
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 108 ± 11 aa |
| Standard deviation of domain lengths | 11.39 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 54.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0040 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822AJ17 | 2-106 | KRILPQIGNMNAAGLDQLVKQYHIKAPNTNNDLSEPIAFNLMFSTTIGATGQVKGYFRPEAAQGMFVNFKRLLEFNQGRLPFAAAQI… |
| A0A4V3SGZ9 | 1-92 | MRSPATNNELSEPQQFNLMFATMIGPTGQCQGYLRPETAQGIFVNFQRLLQFNQGRIPFGAAQIGSAFRNEISPRSGLIRVREFAMA… |
| A0A6V8HPU0 | 429-549 | None |
| A0A445AMK7 | 53-146 | None |
| A0A3Q0KEV1 | 177-297 | None |
| A0A822YG00 | 199-303 | None |
| A0A183L9Y6 | 257-358 | None |
| A0A6Q8PH49 | 240-344 | None |
| A0A1L9UB14 | 155-275 | None |
| A0A6I9YKN6 | 59-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.