DPCstruct | MC22947
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 78 ± 5 aa |
| Standard deviation of domain lengths | 4.92 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 72.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 57.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820TRI9 | 58-130 | QFQTFLSLLRLNEIQSLVIDCYGSSLQLKTWPYLPNLRTLKVKGAQDLVDVFKFAQQHANTLTHLTVESSQYF |
| A0A822ABU5 | 1-82 | QFNTILRFLPLNDILSISIDNDASPLQLTCWPYMPRLRTLRIISVYDYDDLLPFAILHAATLTHIIVNSNERLVPVSINVFF |
| A0A817JWA5 | 21-102 | None |
| A0A820L518 | 3-80 | None |
| A0A817RJ06 | 21-98 | None |
| A0A817RGM6 | 59-143 | None |
| A0A819U623 | 59-126 | None |
| A0A814MI44 | 60-132 | None |
| A0A815DL08 | 61-141 | None |
| A0A819A943 | 810-885 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.