DPCstruct | MC22944
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 191 ± 25 aa |
| Standard deviation of domain lengths | 25.12 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 27.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13815 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A2G088 | 9-161 | QPVIQQFVPPPIQEVSPFSSIDWSLIKELDPDVIRRNKDSSKVKDFISAFQTFTINQSDTKSFNNPLSARLFCLLQVSIDYLFHQHH… |
| A0A6I9MKG4 | 6-192 | ATVEGLSGPLSGAYTLPTFKFQPRRESIDWRRISAVDVDRVARELDVATLQENIAGVTFCNLDREVCNHCRQPVDPVLLKVLRLAQL… |
| A2DZI8 | 1-240 | None |
| A0A7S4A1N4 | 5-161 | None |
| A0A819UBQ0 | 8-208 | None |
| A0A819NT45 | 2-221 | None |
| A0A7I4CAS0 | 56-255 | None |
| A0A2K1IY70 | 86-308 | None |
| A0A5J4VSX4 | 1-201 | None |
| T1GUX9 | 18-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.