DPCstruct | MC22941
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 188 ± 17 aa |
| Standard deviation of domain lengths | 16.63 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 21.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9M1C4 | 10-191 | KDTYILAFAVCYKLNSPESFKICTALREEALIKGDVVSRRACCFAVALALNQNQVEKAMSIFSQIMNPESITCTNLNILIHVRSNML… |
| A0A0B7AF01 | 22-200 | RFNIDCVTLALGAHYHINTPESAEAARNMIRVLMQQYYLSRRALMYAAMLFLKQNLPHVALETLKHCREGTLVFNLQLMCYAKLGQI… |
| A0A044RZ72 | 69-239 | None |
| A0A132A4E4 | 109-336 | None |
| A0A4W6BL85 | 4-175 | None |
| A0A154P165 | 124-307 | None |
| A0A5S6QUT7 | 308-513 | None |
| A0A7R9KK03 | 375-569 | None |
| A0A2A2KBC1 | 37-227 | None |
| A0A0T6B2E5 | 2-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.