DPCstruct | MC2294
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 293 ± 38 aa |
| Standard deviation of domain lengths | 38.37 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6HLD3 | 23-324 | QFKHWFPDWNATLSNIIAQDCAQQYHDYLTNSTSSGTSAEWAMPVIDCMLDAVSEPTKERMSSAAVVLGLTPTILSFLGSTTTETAL… |
| A0A6G1JGX2 | 323-635 | KFRHWFPKYERHWLNASEICTTQLNDYWTANRTRHHATCAVATDCILKNTTETIKSNMASAAIFLGLTPSILALIGPSVMDLSLLSA… |
| A0A168GH99 | 3-275 | None |
| W3XH13 | 2-231 | None |
| A0A1L7XCV6 | 52-330 | None |
| A0A093XDZ6 | 25-240 | None |
| A0A842Z1C6 | 18-313 | None |
| A0A4Q4ZRB5 | 23-313 | None |
| A0A1Q5T410 | 11-286 | None |
| A0A7S8HQZ1 | 9-375 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.