DPCstruct | MC22939
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 163 ± 20 aa |
| Standard deviation of domain lengths | 20.24 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05140 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q2JNP5 | 8-179 | LARWVSSLRRYFRHELLPLLADLRLAIGLLLAIAVLSATGTVIEQEETAAFYQAHYPEHPALFGFLTWRVILSLGLDHVYRTPWFLA… |
| A0A2H1KHX2 | 34-205 | APADIGFVGLLRWAWRQLTTMRAALILLLMLALAIIPASLLPQRIQDPARVASFIEDNGQWGEVLDTFQLFDVHSSVWFASIYILLM… |
| A0A265Q619 | 8-165 | None |
| A0A1A3T902 | 1-136 | None |
| A0A0K2RN18 | 62-217 | None |
| A0A1V1P5B2 | 10-170 | None |
| A0A1V1W802 | 10-181 | None |
| A0A1H3B6D5 | 10-143 | None |
| I0Z470 | 398-594 | None |
| A0A1V3WF26 | 1-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.