DPCstruct | MC22934
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 109 ± 13 aa |
| Standard deviation of domain lengths | 13.28 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P5X8T7 | 4-90 | KKNPGPRRKRMKREQRLLNAKTKWLPNTTAKNIAKSYSKWYGVDLQCAIRELETIGLYFSDEYKKQVVIAYENKIASKQKRKEEREA |
| A0A451C5U5 | 1-111 | MTRAGRLASATATQWVRNYTGKNLVCGYCKWFAVDPLCAVIELRALGAPISAEREEQLRRSAERKSKDRAARKRQRAEDRDEYPDSD… |
| A0A0N1MZG3 | 17-129 | None |
| A0A2V8P9Y9 | 1-115 | None |
| A0A1X1VHA5 | 1-108 | None |
| A0A810DYQ5 | 28-129 | None |
| A0A1S2M3F1 | 1-104 | None |
| M5DYQ0 | 1-90 | None |
| A0A1S1RY41 | 1-123 | None |
| H1YJ01 | 1-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.