DPCstruct | MC22932
Metacluster Properties and Pfam Annotations
| Number of structural domains | 74 |
|---|---|
| Mean domain length (aa) | 116 ± 16 aa |
| Standard deviation of domain lengths | 15.55 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 41.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05669 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q6GQA1 | 10-116 | EQHRIRFQLELEFVQCLANPNYLNFLAQRGYFKDKSFVNYLKYLLYWKDPEYAKYLKYPQCLHMLELLQYEHFRKELVNAQCAKFID… |
| A0A060THA1 | 3-102 | LWWSNKFIQSLANPQYLNFLAQSKYLESEEFLNYLNYLEYWREPENAKYLIYPNCLHVLTLLKEPRFRQEISRADVAKMFMDDFYMT… |
| A0A438E1W4 | 200-319 | None |
| A0A0V0Y6A7 | 4-114 | None |
| A0A5N5K2T5 | 73-209 | None |
| D4DDC7 | 97-239 | None |
| A0A813M9S5 | 283-389 | None |
| F2SDI9 | 2-115 | None |
| A0A5N6PFL5 | 13-135 | None |
| A0A6A3B1T0 | 15-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.