DPCstruct | MC22931
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 205 ± 24 aa |
| Standard deviation of domain lengths | 24.06 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 74.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 23.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04588 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M3JSA3 | 1-148 | MKILSPEEKQAHTSHILAEGFKGLMYGGAFSIGLFQYIKRRHPVRFKSFNPSIKAAIIAMPTISIAAFFADQGSVEFDRNMHQSEYQ… |
| A0A060T619 | 1-200 | MKIPSKEELNDYVSAITWGGLKGGAIGLGLSAAGTMYLTRMKPHYIRNKTTFAKTFFFMFPVLACGVTSMEIASQRFDQSRYGWGEM… |
| A0A0F7SXU4 | 227-427 | None |
| A0A7S2JFN4 | 19-262 | None |
| J4U9Y8 | 20-239 | None |
| I4Y5T2 | 1-219 | None |
| Q6C0I4 | 1-213 | None |
| A0A3F2RTZ3 | 375-560 | None |
| B5Y5T3 | 37-314 | None |
| M4BRW1 | 62-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.