DPCstruct | MC22923
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 155 ± 25 aa |
| Standard deviation of domain lengths | 24.76 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 34.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3SVP5 | 1-163 | MSISYVDDISDGNGAFIFVKILRRWKGSLYKLVWVDLFLYLAVYYAISLTYRFALPEAQKRTFEDVVRFCEGMKGNIPVSFLLGFFV… |
| A0A6J1TIF4 | 1-178 | MTVTYTAEVATSSGLGCFLKLLFRWKGSIYKLLWPNLVLYSTLYFSLSLYYRFVLNPIDREWFERLSIHCQTYGDLIPVSFVLGFYV… |
| G0NYE8 | 1-162 | None |
| A0A1I8IAY0 | 1-158 | None |
| A0A2C9K0Z3 | 1-164 | None |
| A0A3P7CSQ1 | 2-144 | None |
| A0A3P6RC09 | 1-138 | None |
| A0A2A6CBL5 | 1-176 | None |
| A0A368GC50 | 1-175 | None |
| A0A556UXM8 | 3-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.