DPCstruct | MC22920
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 216 ± 47 aa |
| Standard deviation of domain lengths | 46.80 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 74.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 21.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15613 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5M9MU74 | 165-371 | LAKQPKGSKQYQRVLKKIEEQKANIAKLEEKIEVVDNDLREADCPRTRCLGKDRFCNRYWWFERNAMPYGGMPNSSTAEAQYANGRL… |
| A0A0R3SN26 | 5-209 | ASVVKSRRLLAAKAAEEREKRETAVRQRRELEAKIEAQEKALAKAEHDETVATIDYKLSCRARLLGTDRFDRRYWRFTCAPSRIFVE… |
| S2K064 | 617-895 | None |
| U9UQ54 | 138-341 | None |
| A0A1V8UZX6 | 24-321 | None |
| C9SEV1 | 233-534 | None |
| A0A7J7IP84 | 244-419 | None |
| A0A6G1HXV5 | 516-820 | None |
| A0A7I8KFB2 | 405-586 | None |
| A0A1Y1VA12 | 265-490 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.