DPCstruct | MC2292
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 123 ± 11 aa |
| Standard deviation of domain lengths | 10.99 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G1G4M5 | 246-362 | LDELVRRTNLAVQLVNSQLTISSRYAQMQPKMCTDGRFPEDFKTAKTLEEVRVIDPSTLDRILSAYNLPTDLRSLRMTSRDPFSPKM… |
| A0A6G1JAJ7 | 11-138 | EMVRRTNLMVQFVNSQIRPAGRYCQVQPKMCPDSKFPPEFRVPKTVEEIRAMDRTLRLGIGSSVVTNEPAASSVDRLLRAYHLPADL… |
| A0A194XFN7 | 364-507 | None |
| M2N331 | 30-147 | None |
| A0A6A6CKA3 | 3-104 | None |
| A0A2V1BTE1 | 57-183 | None |
| A0A6G1HQT9 | 11-121 | None |
| A0A5N6JPX7 | 32-162 | None |
| A0A2D3UVU8 | 85-197 | None |
| A0A2J6SLF9 | 197-329 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.