DPCstruct | MC22919
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 86 ± 7 aa |
| Standard deviation of domain lengths | 7.40 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 56.42 |
| Pfam Score | 60.00 |
| Assigned Pfam label(s) | CL0039- PF00795 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q4XZ33 | 234-318 | IDEVYQAQRNLIVNTLNFEPKFKVEGGSVSENLTLQNIQARSRMVTAYEFAQILPTTRGRPGGGSLLVLGSANVGESLRGYLTKY |
| A0A5F4W7X9 | 447-519 | IDPAVKAVMGIFSLVTGKSPLFAAHGGSSRENLALQNVQARIRMVLTYLFAQLSLWSRGVHGRLLVLGSANVD |
| A0A3F2S540 | 657-739 | None |
| A0A7M3RGG3 | 185-289 | None |
| M5E736 | 815-901 | None |
| A0A822HW39 | 260-346 | None |
| A0A7T8HL04 | 115-199 | None |
| A0A1S3DQT8 | 301-387 | None |
| A0A137P3Q9 | 454-540 | None |
| A0A446PEA1 | 125-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.