DPCstruct | MC22918
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 126 ± 8 aa |
| Standard deviation of domain lengths | 8.13 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 51.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0111 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C6NFD7 | 51-168 | AGLLAACFIAIVPGYISRSVAGSFDNEGIAIFALQFTYYLWVKSVKTGSVFWTIGCCLSYFYMVSAWGGYVFIINLIPLHVFALLLM… |
| A0A0R3SM85 | 15-128 | VAGSYDNEGIAIFALLLTYFLWLRAVRTGHLLWSVLCALAYLYMVSAWGGYVFIINLVPLHAFVLCLTGRYSSRLYVAYTSFYILGL… |
| A0A812XF59 | 523-652 | None |
| A0A813FJU4 | 2-129 | None |
| A0A2T7PF01 | 463-591 | None |
| A0A5J4W627 | 129-262 | None |
| A0A7I8VU91 | 649-778 | None |
| A0A1Q9D9W9 | 561-693 | None |
| A0A504XK01 | 496-626 | None |
| A0A2V2WVS8 | 200-334 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.