DPCstruct | MC22917
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 166 ± 19 aa |
| Standard deviation of domain lengths | 19.12 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 35.53 |
| Pfam Score | 91.11 |
| Assigned Pfam label(s) | CL0542- CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S4ERJ3 | 7-169 | DDIKNAFEIAPRDQPSIIIVTKSPEDKKSWFSDLIMVNTKSMLERTLDSIILDEEKKHPLRMPSPEYYSFAEPDSCENIILEEKQNT… |
| A0A368FA36 | 1-158 | MEDSEVLRHSFRLESREKPDTTRTFTMICKTAEEKMDWMSALVTVNTKSLLDRVLDGYEKEEAKRIPLITPGPEQYRFAEPDSEENI… |
| A0A833S438 | 6-142 | None |
| F1KUD9 | 55-254 | None |
| A0A8B6H8C8 | 318-490 | None |
| S4S047 | 355-528 | None |
| A0A820W0J6 | 36-187 | None |
| A0A7R9LB30 | 2-129 | None |
| A0A815NF26 | 160-322 | None |
| A0A0F8AS79 | 123-297 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.