DPCstruct | MC22912
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 145 ± 21 aa |
| Standard deviation of domain lengths | 20.65 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 66.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 23.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0459 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3SHA8 | 1-111 | MSRKTSSTFPLTGKRVFLHLIRSDQLTKILSRLGADVRPFFDRSVEIVIYNPGARQSPTSIQNVQQTPSPSLSRGRAMVMAANQGAT… |
| A0A834RC62 | 3-140 | NESVSKSNPKPFSKYSFFLDTKNSSHLNSLLQKHIVELGGKIDCFITKNTSCFVTSRPKSEWNNYNCQTESPTPKLILNPNNAFSRG… |
| Q283Q6 | 13-153 | None |
| A0A0P4WG40 | 15-171 | None |
| A0A507R4G0 | 128-242 | None |
| A0A319DRT8 | 38-195 | None |
| A0A7M5WST2 | 2-111 | None |
| A0A7J7U7G8 | 11-182 | None |
| A0A665UK32 | 1-185 | None |
| A0A2R7W0D1 | 15-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.