DPCstruct | MC22911
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 57 ± 2 aa |
| Standard deviation of domain lengths | 2.19 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 78.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 62.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0750 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9PMJ9 | 156-211 | LRPGSPCDNFQGYCDVFFKCRAVDAEGPLARLKNLLFNKETLLTVAQWITEYWWAV |
| A0A5B7DKL8 | 504-559 | GGSPVFMLPGAPCNNFQGYCDVFQKCRAVDAEGPLARLKNLLFNQDTLNSVAEWIT |
| A0A1Y3BV75 | 32-85 | None |
| A0A5J4P1G9 | 1-60 | None |
| A0A2H2IRB3 | 5-63 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.