DPCstruct | MC2291
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 58 ± 7 aa |
| Standard deviation of domain lengths | 7.14 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 40.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A423SJN5 | 625-680 | ENNCKNKNKKIYTNKCSANGCKTKEMVPVSCNACGLNYCLRHRHTTDHDCKGPATS |
| A0A2H1WHZ1 | 63-126 | RRKVFTNRCTFKGCKNKEMVPLVCSECSLNFCLRHRHGSDHACEGKLAAKRRQAAEAAMARMKA |
| A0A5F8ACM3 | 133-189 | None |
| A0A2E7LSS4 | 1-62 | None |
| A0A433QVQ0 | 42-98 | None |
| A0A811KI88 | 92-139 | None |
| A0A2P6NNG6 | 102-155 | None |
| I1CVP5 | 36-90 | None |
| S9XNV0 | 8-62 | None |
| A0A2K6WE82 | 7-62 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.