DPCstruct | MC22909
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 132 ± 11 aa |
| Standard deviation of domain lengths | 10.75 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.65 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 45.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03250 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4WGC3 | 75-201 | GANKKLFGKDLSEYDNMDMDDMLDQLTAEEIELLTRDVDPDDTLMPPDQRTSYRCDKSATGPLNRKQLIDHINEQAMTEPDRPELVP… |
| A0A183JIF2 | 41-165 | MSNKLLFGKALTSYDDEDIDELLSKLTPEELEQLNDDFDPDNSLLPPSQRCRDQTTKTPTGPYDREKLLRYLIEKAKAERDWEEAVP… |
| A0A132A497 | 35-152 | None |
| A0A023FRT1 | 23-177 | None |
| A0A0R3T947 | 1-128 | None |
| A0A194QTS4 | 2-141 | None |
| A0A4Y7MGV5 | 1-127 | None |
| A0A654H9P1 | 1-126 | None |
| A0A7R8ZIR7 | 31-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.