DPCstruct | MC22901
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 98 ± 7 aa |
| Standard deviation of domain lengths | 7.47 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 43.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0208 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U1LJW4 | 1-106 | MIANLGRKMPDFVPELLVPVDYRDSSPKIFNSGCNLLSEPWEKLYDDMLTRFDLSLRKIDGQISLGDMTRESDASARFVITEFVERK… |
| A0A7J6VEH8 | 63-150 | MCLLVSSDYPNCSPVFLDKLPLELSKEQEHLLLKARSKFTRSIRCLSQPISVTEMAKSWDTCAGAVILEYSVQNGGGSFSTRYGTWKT |
| A0A834TQM0 | 589-691 | None |
| A0A396GHJ0 | 93-189 | None |
| A0A453A853 | 325-419 | None |
| A0A816INL5 | 339-432 | None |
| A0A078G3P8 | 82-175 | None |
| A0A6J1I7W8 | 249-342 | None |
| A0A3B6GKX1 | 97-192 | None |
| M1D605 | 1-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.