DPCstruct | MC2290
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 155 ± 5 aa |
| Standard deviation of domain lengths | 4.85 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 86.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 25.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5Q4ENT3 | 596-743 | FVPWRDYRVYMSNLDEDLRGRIIGVPGVRSDRPNLDLGSRFEVVITRNILTYFLLPIACTLFRTVNIMGCDGRPLKENDYFWRHDPS… |
| A0A1V4PY97 | 1-154 | MIVQSEFRAVESLLVPVPWGEHTNIAVDLNDQFFLPDVENVLANLLLPLGCSLSRDVRMWGFDGRGPSDSGFWANSDRHAYPELMQS… |
| A0A202DBW5 | 44-196 | None |
| T2JL49 | 1-159 | None |
| A0A5A9F7L0 | 72-225 | None |
| A0A267MHZ2 | 456-607 | None |
| A0A522A4K8 | 256-407 | None |
| A0A2D6PQM3 | 352-516 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.