DPCstruct | MC229
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 200 ± 13 aa |
| Standard deviation of domain lengths | 13.33 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 69.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A485KYD3 | 209-400 | CQSGVVTVGSWTRVLMLLLVDIVALVAGYLVGFAYVWKHKKQSIPEAPLMLHGTAEVFLQTHSSDDTGKAWQLDSVASVMTGLIPFG… |
| T0QP43 | 1-192 | MFVLTLINGLCNVFVLGCVRAYASWRPAEVPVRHREAKHLLSAASDAFFGHANADVWSVSPALGCMSGLLTFEWRGHKFLFDTKLWL… |
| A0A1V9ZZ18 | 1-199 | None |
| A0A1W0A5B6 | 271-485 | None |
| W4GU01 | 28-248 | None |
| A0A067BWR2 | 87-273 | None |
| A0A1V9ZWE1 | 222-415 | None |
| A0A1V9YRM8 | 1-182 | None |
| A0A6A5ATU1 | 235-449 | None |
| T0R6M1 | 763-950 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.