DPCstruct | MC22898
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 97 ± 13 aa |
| Standard deviation of domain lengths | 12.84 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 69.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U1NNR6 | 904-1010 | PVWTAWTNAMDAVHVGDVDTAFAEVLSTGDDLLLVKLMDRTGTVIDQLSSEVGTEVLHAVAQFLPDQNVFDICLAWLQQLLDMIVEN… |
| A0A1J3HEP0 | 1-87 | MDEDDDGRGGQGRDPVWTCWSNAMHAVRVGDTDSAFAEVLSTGDELLLVKLMDKTGPVLDQLSSDIGNELLHSVAQLLLDHTLFYYL |
| A0A1D6EX72 | 289-379 | None |
| A0A427A8M1 | 394-479 | None |
| A0A2N9I347 | 524-630 | None |
| A0A2I0JHX6 | 240-320 | None |
| A0A251U3Q6 | 305-422 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.