DPCstruct | MC22897
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 110 ± 11 aa |
| Standard deviation of domain lengths | 10.81 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 43.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5K4FC20 | 1500-1602 | LSTSPGLDLFRYVLLVGSPQDRYVPYHSTRIELCKAAIKDSSTLGIIYMEMVTNLLQRFIQSTRTTVVRYDVHYNLTNSANTLIGRA… |
| A0A2U1LDW2 | 6-137 | LALPATFSGDGDCARSVSSDTTVETITNKIVMADNEDGYVPYHSARIEMCQASSQDYSKKGQVFLEMLNNCLKQIHSPSSEQRMFMR… |
| M8BSC6 | 723-838 | None |
| A0A0P0XZ90 | 182-300 | None |
| C1MTY3 | 155-283 | None |
| A0A4S8IH94 | 1048-1163 | None |
| A0A3Q0JFC3 | 26-140 | None |
| A0A817KVY5 | 661-779 | None |
| A0A7S3FS89 | 357-467 | None |
| A0A7S3VZH0 | 1-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.