DPCstruct | MC22896
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 90 ± 11 aa |
| Standard deviation of domain lengths | 10.80 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 69.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 51.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U1L5H3 | 9-80 | FFDKVVKVKGPKCRKEVERLDGWIKFFLESGSEPLRLAHLLLAKAAVCGEGEGERVEFPDTVDEFLHNDPPS |
| A0A251RTE4 | 123-203 | MPEVGDDEFFDKIVKVKGPKCKKEVERLDNWIKYFLNSGREPLRLAHLLMAKAAVVAAAGGDELEFPCTVDEFLENDPPTA |
| A0A2P2P049 | 164-259 | None |
| A0A4S4DJZ6 | 193-282 | None |
| A0A835IND7 | 1-106 | None |
| A0A834YB76 | 13-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.