DPCstruct | MC22886
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 60 ± 6 aa |
| Standard deviation of domain lengths | 6.09 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 41.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H0KAP9 | 2-51 | RLEATDGPFVAGSGPVVAGRTLALVMALAGRASYCDELSGDGVQALRERC |
| A0A7V9GW95 | 7-61 | ARRRLRGLRLVATDADLSVGDGALVEGTVGDLLLLITGRTAAATRRLRGPGVEQI |
| A0A837ZPB0 | 127-184 | None |
| A0A810NLW4 | 3-54 | None |
| A0A4Y3W1W9 | 14-71 | None |
| A0A1H8DGT1 | 29-99 | None |
| A0A2S6X3N2 | 106-169 | None |
| A0A419HMD7 | 47-106 | None |
| A0A7I7MPS8 | 307-369 | None |
| A0A3M0GAI1 | 4-62 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.