DPCstruct | MC22878
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 285 ± 19 aa |
| Standard deviation of domain lengths | 19.24 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D8EVK9 | 1-296 | MSDIPPMDVTEDDLAISAQEEQDARDAVEIIRDTLRQYGLEDLTSEAYNMLIDGSSTEAVVLRLRESESFQERFKGMQMRTDNKLPG… |
| A0A1E5P415 | 124-396 | NRDAYMALKSLFSQYGLGSLAGKIFEYVKQGYGADTIGLLLQDTKEYKERFAANEVRAKAGLPVLNPAEYLSAESAYRQILNSAGLP… |
| A0A424NTP5 | 1-275 | None |
| A0A411YDX3 | 196-474 | None |
| A0A094P8U5 | 160-452 | None |
| A0A7Y3L823 | 264-567 | None |
| A0A2E7TLY5 | 68-330 | None |
| A0A2E7W0E2 | 286-550 | None |
| A0A2E7S9S8 | 91-418 | None |
| A0A2E2S904 | 225-497 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.