DPCstruct | MC22875
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 243 ± 27 aa |
| Standard deviation of domain lengths | 27.22 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 19.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C4UM19 | 21-290 | ALALTLVLAALVGSLAAWAGWQTAEPLPSDEQAVAAAARAVPDQAGYELRRRDALFVYDYAGDGGVERAVRAVVGDDDYVPGYVEVT… |
| A0A6I5WQ99 | 5-233 | GAVLLGTAGLSAGAWYGGRGATPPTPERSTAVAEELLPGTHASGSMIVRGWRYGVVLADDDYGSGRTELHYGESPDCALTGLLRRTA… |
| A0A6F8XQJ4 | 22-216 | None |
| I0H5C6 | 24-271 | None |
| A0A327Z804 | 2-240 | None |
| G2FKG8 | 37-231 | None |
| A0A1C4YWR7 | 5-230 | None |
| I0H9J8 | 22-240 | None |
| R4LNM7 | 71-335 | None |
| A0A316FCR2 | 140-404 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.