DPCstruct | MC22874
Metacluster Properties and Pfam Annotations
| Number of structural domains | 102 |
|---|---|
| Mean domain length (aa) | 132 ± 24 aa |
| Standard deviation of domain lengths | 23.59 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 90.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11303 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D6KC01 | 4-111 | PVGGDHNPVWQNCNGDVYTAPIENEHAVHALEHGAVWVTYNAKAAKADVAALAEKVRRTPYTLMSPVADQKDPIMLSAWAHQRSVSG… |
| A0A6I5WIU4 | 13-123 | QVRYNSQPPTSGPHFAFSLAPGRYTVAVPEGLAVHAMEHGHVIILYAETTPESTIADLERVAKRHADKVVLAPSEKLSDGIAMTAWG… |
| A0A6J4HLN2 | 26-160 | None |
| A0A7W0WAV5 | 170-322 | None |
| A0A1I0FUE4 | 48-199 | None |
| A0A350XP62 | 292-427 | None |
| A0A7R9L0W7 | 17-155 | None |
| A0A518LIM3 | 150-283 | None |
| E7F4B0 | 50-193 | None |
| A0A258H948 | 2-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.