DPCstruct | MC22870
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 212 ± 38 aa |
| Standard deviation of domain lengths | 38.42 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 88.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0471 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A850MGC7 | 134-318 | RLALIDGTFALEGQGPTLGTPLTLNLCLAGTDLVAVDSIATTLMGFSPSEITHLRLAALQGLGEIDIAKIKTVGVPLDSVSQQFLKP… |
| X1SGL9 | 6-180 | VRLNTVLAAKNVLAADIVAASMLGYRIDEVEHLLLAAQAHLLGPADLEEIKIISPKKLKELQSDRVNSKEFPFYLPGLKVIEKGTCS… |
| X0SH03 | 1-143 | None |
| A0A174ACE6 | 30-237 | None |
| A0A3D3CF68 | 187-380 | None |
| A0A7X8K2H8 | 71-319 | None |
| A0A7C1MRE2 | 35-230 | None |
| A0A482D7G3 | 274-460 | None |
| A0A413QZG4 | 779-977 | None |
| A0A7X9DEC3 | 2-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.