DPCstruct | MC22869
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 228 ± 21 aa |
| Standard deviation of domain lengths | 21.36 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 24.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A554LIJ5 | 489-706 | NVSFTCEKLDEILNNPQYTPEDILNLFNSDFKDIFNSSIGVWEGYSLREHTLMVMKQFRKYFKGKPLPANIEEKKIEIILALHDIGK… |
| X1SEG9 | 15-205 | KLSFSRTELDKVLESSEYTPKSLITLFEKDLGKIFNTDSGVREKYSVKRHTLMVIGQFEKYFANQELPAGMSKNFFRTFLALHDIGK… |
| A0A1F3SUQ4 | 38-265 | None |
| A0A7X5Q9Q9 | 22-250 | None |
| A0A6G7C7C5 | 811-1022 | None |
| A0A0G0RBS3 | 9-238 | None |
| A0A0G2ZBS8 | 511-750 | None |
| A0A3C1ENG1 | 191-416 | None |
| A0A839JM81 | 309-501 | None |
| A0A522QI16 | 32-312 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.