DPCstruct | MC22868
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 256 ± 40 aa |
| Standard deviation of domain lengths | 39.58 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 40.60 |
| Pfam Score | 57.54 |
| Assigned Pfam label(s) | CL0007- CL0237- PF12072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D0UXB5 | 33-252 | QKEVDEIVQQQVTKLSELAHLSKDDAKKQLMDQVEQEYQSDFTAFIEKLKNVKKEEADKEAAMIVSKSLPRVAVDSVSEFTTKTVDL… |
| X1S686 | 42-300 | ENRLAQKTESLERKLEGLEHRERNLGNQEKKIESTRSQLEEVRNRQLRQLELISGMSSAEAKQTLLETMEVEIQEEASRRLREWEAK… |
| A0A2V5X0L0 | 209-520 | None |
| A0A835G3E7 | 53-358 | None |
| A0A061NW83 | 3-227 | None |
| A0A0G0EJE0 | 11-306 | None |
| A0A7V3EQL5 | 86-387 | None |
| A0A0G0S545 | 43-342 | None |
| A0A7X1E7W7 | 66-291 | None |
| A0A4Y8I2G4 | 1-258 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.