DPCstruct | MC22865
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 371 ± 85 aa |
| Standard deviation of domain lengths | 85.35 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 81.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 26.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13910 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K5XR57 | 3-291 | LTSCLERALGDVFLLIGKECPFLLRDLLASVELAQVFGQSVMNVLKVFVGSPCGLNLRNVLWHGFASPEEVPPKYCSMMMLLTAGLG… |
| A0A0R3W279 | 22-414 | RSIAHTMRLCQENFYTDAFQFNAYSLSWLNMPLHFVRLRNIVSSGNHIDRFVSILQLISMLDFSLSHLLVDEAGRTPKNLTAALDDP… |
| A0A7F8RNJ0 | 69-381 | None |
| C3ZMU6 | 12-503 | None |
| A0A067BZM6 | 3-235 | None |
| A0A7R9A5H7 | 61-361 | None |
| A0A6A4VHL2 | 75-360 | None |
| A0A0W8AYY9 | 2-543 | None |
| D2VTW7 | 119-625 | None |
| A0A7J7KRF8 | 40-494 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.