DPCstruct | MC22862
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 117 ± 12 aa |
| Standard deviation of domain lengths | 12.34 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 37.45 |
| Pfam Score | 97.06 |
| Assigned Pfam label(s) | CL0661- CL0321 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820QUJ5 | 4-106 | TVYLTMIFTSIIYIILMIYARFKDKRDFEKLGVTPLADNNKSDHYYYQILVFTGQRANAGTDSKVYFVLSGDDDQTQIRLFSDPHRK… |
| A0A2C9KRF7 | 1-123 | MSFNFLPNTIHFATVFSKFDIKGQGLVLGVLISLYLLFTCIALWAHYMDRKAMFQWGVFPLSDNYAYDDYFYLITVHTGLRKSAGTT… |
| A0A6J8DWY7 | 419-546 | None |
| Q2EG98 | 1082-1187 | None |
| A0A1I8IF65 | 623-752 | None |
| A0A820DR46 | 187-316 | None |
| A0A0R3TB24 | 5-89 | None |
| A0A813QQL6 | 2-102 | None |
| A0A2H2IV75 | 199-305 | None |
| A0A815K118 | 206-331 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.