DPCstruct | MC22859
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 85 ± 7 aa |
| Standard deviation of domain lengths | 7.26 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 54.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11373 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J5F604 | 1-76 | MDLERDIFKTGSAQAIAESLKRSSTHSKRRKGTPFQSAMSMLNFYINRAGRNLPKARRATLQQAKRKLREAFGREP |
| A0A1T5FZ64 | 9-94 | SAQVTRGSDALDLESEIFKQDDPRRIARSLKRSAERSRRRKASPYRSAMSMLTFYINRAGSNLPAGRRHVLESAKHSLRRLFHREA |
| A0A399VTG5 | 4-87 | None |
| D6V383 | 55-137 | None |
| A0A2V7U7B3 | 19-113 | None |
| A0A5Q0CE12 | 65-138 | None |
| A0A4Q5ZP01 | 38-123 | None |
| A0A3M1DCC4 | 1-89 | None |
| D2UD47 | 108-198 | None |
| A0A6A7M6I3 | 2-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.