DPCstruct | MC2285
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 113 ± 9 aa |
| Standard deviation of domain lengths | 8.84 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 44.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15075 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I8VX34 | 333-451 | RRSVNKIYKTPPTPPPQALQTKEKNFVLDSVASSSISIDYSKTNPKLGPVIPPYNSQRDKHCDTYFRFFGVEETLDKTRQKKPEDTS… |
| W5N1T8 | 1-124 | MLLKRRNSRHLAPTSNDSEFRGREKFFILDCVAVESIARDYNRSLPRLGSVIPPYNAQDDKNAKGYFRTKPVPPLLQQTGQARGGTS… |
| A0A1L8ES07 | 99-197 | None |
| A0A814D8G3 | 19-140 | None |
| A0A6P4Z888 | 177-293 | None |
| M7B7B1 | 7-112 | None |
| A0A095A1T3 | 1-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.