DPCstruct | MC22849
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 95 ± 8 aa |
| Standard deviation of domain lengths | 7.64 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F0ZA65 | 427-522 | LTKIDLYLKAIDCDENSSNAYNNLAAHVDKHQIICLLNGTKMSKKDLYLKSIDCNPQNANGYNNLALFLSNNDDKIQLLNGIKMNKK… |
| A0A7S1RF19 | 12-97 | WTEPPAANLLLPDGRRWGRRELFLRAIELDPAAASAFRGLAGTMVGPPDCVQLADGCVMTKKDLLKRAMALERWERKAFDPLTKER |
| D3BP73 | 1-116 | None |
| D3BI24 | 1-101 | None |
| D3BH35 | 97-188 | None |
| D3B635 | 48-143 | None |
| D3B4W3 | 1-84 | None |
| D3B4B5 | 15-108 | None |
| A0A813I228 | 40-132 | None |
| A0A7S1AUT2 | 169-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.