DPCstruct | MC22845
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 115 ± 14 aa |
| Standard deviation of domain lengths | 14.08 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 40.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A533YS47 | 492-588 | ISAGLIDCHSHTAIAGSVNESGAAVTAMVRIGDVVDADDIAIYRELAGGLTSANLLHGSANPIGGQNQVVKLRWGALPEAMKFEGAM… |
| A0A1Q3EGY7 | 16-133 | YHHLSVIDANGSWLSPGIVDLHSHLGDQSSPKLSGSADTNSRKGLVQPWLRSLDSLNTHDDAYQLSISGGVTTAVILPGSANAIGGQ… |
| A0A5N5QAN1 | 121-266 | None |
| C9SB19 | 185-286 | None |
| A0A067N346 | 1-106 | None |
| A0A2X0MJY1 | 89-202 | None |
| A0A838Q704 | 598-717 | None |
| F5HF40 | 164-282 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.