DPCstruct | MC22842
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 279 ± 66 aa |
| Standard deviation of domain lengths | 66.01 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 78.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 18.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14145 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6T8JY80 | 24-225 | PEFSPAWKVWHSIFFIVGGWSFVFGTWMLLGYPEWDGRLYYSALWYTIGSAGFLCLDTQEAVTYAQESKWVRMNIMCNWWGSVLYLV… |
| A0A1Q3E6Q5 | 9-270 | VSWWVAMAFTVGSIIWVVNGFYSFLPFVDTSFSMSTSGIGWTAWVGATVFEVGAVLGVLEAWNRGETANFGWGVRQVLGYENILETS… |
| A0A2K1QWQ9 | 86-389 | None |
| A0A2S5B7V5 | 13-489 | None |
| I0YX60 | 62-331 | None |
| A0A1Q9E0C4 | 282-502 | None |
| A0A812Q4J4 | 24-267 | None |
| A0A3M6W014 | 119-354 | None |
| A0A365N0K9 | 571-910 | None |
| A0A4U0VG18 | 315-674 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.