DPCstruct | MC22841
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 248 ± 20 aa |
| Standard deviation of domain lengths | 19.51 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 36.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y9YZ11 | 117-339 | MERIRELYELRFSTINPVVDLIDRCVGVQWYATPNFWDGGVDDAWTLNMDPPETFFHLATYGELFAPAFDTFLDTGVVPEAMDVDTR… |
| A0A1Q3E6E3 | 1-221 | MAGEQWYQADNFWNGGVSEPATLQTESNRAAYQIIIYSELFASTMEAYLEPKKNLPKFDLGVRLDYIKYCIPDWTCRSYPGLEVLSV… |
| A0A225AS64 | 115-393 | None |
| B8NPT3 | 111-351 | None |
| A0A1L7WYL9 | 110-342 | None |
| A0A6A6Z4Q0 | 1-269 | None |
| A0A084BCE4 | 111-364 | None |
| A0A5M9MAL5 | 110-351 | None |
| W2RQX2 | 113-378 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.