DPCstruct | MC22839
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 122 ± 13 aa |
| Standard deviation of domain lengths | 13.04 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 36.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A401GF29 | 61-180 | RWLEPEGTPKESTRALEMTTFTLRLRERITRVYDTAFLVPASRPFATWELAEMFQLPRAEAAREKSAGLLPREETIAETTNKDGKVI… |
| A0A1Q3E019 | 22-162 | TGLIAWVGRPYVTTLRRIDSNDGGAMGLEFTTANWRLQTRITRVYDTSFLTNTDRPFAKWQLDDELVLPSSTTPSSTPYARPNSEET… |
| A0A0C9V0X6 | 97-202 | None |
| J4HT15 | 968-1095 | None |
| A0A4T0KN16 | 4-125 | None |
| A0A2N1JEK8 | 160-276 | None |
| A0A0D2PDD3 | 1-104 | None |
| A0A5C3EUZ2 | 577-711 | None |
| A0A0P1BNX5 | 2-148 | None |
| A0A0W0FVD5 | 32-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.