DPCstruct | MC22837
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 215 ± 24 aa |
| Standard deviation of domain lengths | 24.20 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 24.21 |
| Pfam Score | 86.36 |
| Assigned Pfam label(s) | PF18296- PF06333 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A167JND6 | 1-225 | MLAGIHQDVPHIVVYVFCPASQLQALGNALAGSFDALSSGRMLVHLIPESSLLYASRVCFSRPSPLDVTALAVYNGLLRKVKRTTLR… |
| A0A3P7P1Y1 | 1-227 | MVGAEENPLVARVVTVALMRAFNALLYRLNNKRRPQLQLEIIALQNVFDYTGVSADFLKDERGRLNGYDQGRLEKSQNERLSSSDSI… |
| N1QJ49 | 667-885 | None |
| A0A267DTB0 | 775-972 | None |
| A0A3Q0KPJ3 | 1682-1854 | None |
| A0A448WPS6 | 2-185 | None |
| F6W6M4 | 43-265 | None |
| A0A7J7JGT3 | 319-555 | None |
| A0A182SUU3 | 1-193 | None |
| H2Z3Q5 | 1-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.