DPCstruct | MC22833
Metacluster Properties and Pfam Annotations
| Number of structural domains | 98 |
|---|---|
| Mean domain length (aa) | 292 ± 65 aa |
| Standard deviation of domain lengths | 64.79 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 71.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 22.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7DNX2 | 11-343 | VKEPDGRGTWGILSTCLLTITLCCWTSVCPNLPAKSDGDWARLRDKFHLACMGILGPEFLLMLAAGQWSSARTSVKEFRRLNNKRGK… |
| A0A1B8DHB8 | 13-301 | GWTSSPDGRGTNEIILTCLFTIVLCCWTSVCPNLPALSDGRWAQVRDKLDLTCIGLLGPEFLLMVAVGQRSSARRSVKKFREAGFAR… |
| A0A137R040 | 449-768 | None |
| A0A6A4H1Y8 | 17-226 | None |
| A0A2J6TH71 | 11-286 | None |
| A0A401KNH6 | 215-558 | None |
| A0A5C3L8I3 | 20-326 | None |
| A0A2T4BB29 | 34-319 | None |
| A0A4Y9XT55 | 200-561 | None |
| A0A5B1QW87 | 11-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.