DPCstruct | MC22832
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 173 ± 32 aa |
| Standard deviation of domain lengths | 32.12 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 80.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 28.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C7YN37 | 31-157 | TGLKDGSYLYNRSERDVFRILIDCFRLRLEEQSQHDKKGAEGTIYAGADDSLPAFRQFLELAATREDLLPPWWTPEKQRECEEFGMS… |
| A0A1B8DH04 | 29-174 | LMRCAKCLTALYCSLECFQAMNDMFGLSNDDFLHDRPEGEVFNLLIDSFRMRVEDESVYGGNTIGVYNGENILPLFKKFLSLAESRQ… |
| A0A5C5FTD1 | 13-206 | None |
| A0A438MY20 | 210-395 | None |
| A0A6G1IT08 | 8-166 | None |
| W9WLK3 | 8-156 | None |
| A0A1V6T2Z0 | 59-265 | None |
| A0A1Y2CBV6 | 33-225 | None |
| A0A6A5QIS1 | 72-259 | None |
| A0A0F4Z6B8 | 150-350 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.