DPCstruct | MC22831
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 145 ± 11 aa |
| Standard deviation of domain lengths | 10.52 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G1FV18 | 13-157 | NAQIEKFINKINKKVTQLKINDLTRGDQDLLRNRLKIVWAEPNDHDGSATKWRKARAHRAYKEIQDESDHLLLVVVLVIAPTEIAKT… |
| A0A1B8DFM5 | 5-154 | AQINKFLTKIDEKSKQLRINDMTRVDQELLKNRRLDLIWGDLIVEKADSQDAQLRTWRKSRARRVYREIQDTSDHLFLAFVLAIPPT… |
| A6QSL3 | 7-147 | None |
| A0A094FS74 | 2-155 | None |
| A0A1V6TTV1 | 1-149 | None |
| A0A319D688 | 7-151 | None |
| A0A318YDH3 | 2-128 | None |
| A0A2C5YKI0 | 3-158 | None |
| A0A0F7TZ46 | 103-248 | None |
| A0A2T2N7F6 | 3-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.