DPCstruct | MC22830
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 117 ± 10 aa |
| Standard deviation of domain lengths | 10.37 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 43.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C6SHX3 | 8-105 | LLDAAVRKQLDDHGRVLPPWRAYPQIERFSIGWRMGDGEWHLMVWWHWWESAPMNEAERIAYFQADEPPREWLDWVAHQIWPDVDFG… |
| A0A1B8D3W9 | 1-126 | MSKPWIDSQISELIAEHGTVPPPYIKHPDIHPLEIFWRMGSGESYIMVYGAWWERQKPLMDETQKIEYFRQFPPPPLWLTWMIDLLW… |
| A0A810NQ49 | 1-107 | None |
| A0A179F1C1 | 50-177 | None |
| A0A4Q6A3H6 | 8-132 | None |
| A1DFD8 | 1-114 | None |
| A0A179HCY1 | 1-123 | None |
| A0A5N6V168 | 101-227 | None |
| A0A7G5ITX6 | 343-456 | None |
| A0A1B8EER5 | 1-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.