DPCstruct | MC2283
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 131 ± 14 aa |
| Standard deviation of domain lengths | 14.42 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 19.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B9XQ21 | 113-252 | FRKPFTLTLHVDKEHYYEEEFPGIPYVHKGNVYLFKGDSFGINLDITNNTIRNVVYQADTNKAAVTLQFTQDVSTNGEAMMILVIKN… |
| A0A444WEE8 | 6-125 | SPYFVKDDILQIYPTEKLFIETEVKNDTIYSMKVVKENLYPEKTITVDFKQSAEDRSKVSMFLTVKNPFDKNLIYKARMFTPFSNEL… |
| A0A7W9CG19 | 36-170 | None |
| A0A1G0XRP8 | 46-185 | None |
| A0A7L5Z6P4 | 2-159 | None |
| A0A516HBT6 | 78-190 | None |
| A0A3G9G9I3 | 24-177 | None |
| A0A1E4GYA7 | 96-238 | None |
| A0A0Q9ERD4 | 15-140 | None |
| A0A2N0TNG7 | 19-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.